Angiotensin IV comes up often in conversation and rarely with the context attached. Here we lay out the basics in order, then work through the practical considerations.
Last reviewed on 2026-05-02. Where a claim depends on a specific study, the study is described rather than over-claimed.
Reported effects of dihexa are often described in terms of synaptogenesis, a process by which neurons form new synaptic connections. This concept is biologically plausible but difficult to measure directly in living humans. Animal behavioral tests can suggest memory or learning changes, yet such tests have limitations and may not translate to people. The literature includes conflicting or incomplete findings, and some studies are small. As a result, the mechanism remains a subject of investigation rather than a settled explanation.
The proposed mechanism of dihexa involves activation of hepatocyte growth factor and its receptor, c-Met. In cell models, this signaling pathway is associated with dendritic spine formation and synaptic reorganization. Dihexa is described as a stabilized analog of angiotensin IV, which also interacts with related systems. However, the precise binding profile and downstream effects remain incompletely characterized. Most mechanistic evidence comes from in vitro assays and rodent studies rather than human trials.
Discussion in the literature often separates direct receptor activation from downstream growth-factor modulation. Dihexa is not simply an angiotensin receptor blocker or a classic nootropic drug. Its proposed action may depend on endogenous HGF levels, which vary by tissue and physiological state. Questions remain about brain penetration, metabolic stability, and active metabolites. Reviews note that mechanistic claims should be treated as hypotheses until supported by independent studies. That distinction is important when interpreting promotional claims or early laboratory findings.
The leading hypothesis for dihexa centers on hepatocyte growth factor (HGF) and its receptor, c-Met. In cell-based assays, dihexa has been reported to potentiate HGF-dependent signaling. That pathway influences cell growth, survival, and motility. Because c-Met signaling is widespread, the proposed mechanism is broad rather than specific to neurons. The exact binding site and stoichiometry remain areas of active investigation, and independent replication is limited. This uncertainty limits firm conclusions about how the compound acts in living organisms.
Animal studies have examined dihexa in models of cognitive impairment, synaptic plasticity, and memory. Some reports describe improved performance on maze or avoidance tasks after administration. These findings are preclinical and often involve small samples, varied routes, and differing formulations. Results in rodents do not establish effects in humans. The absence of published randomized controlled trials in people is a major gap in the evidence base. Observational reports and user accounts do not substitute for controlled clinical data.
| Property | Value | Notes |
|---|---|---|
| Primary reported target | Hepatocyte growth factor/c-Met signaling | Findings mainly from cell and animal studies. |
| Related endogenous peptide | Angiotensin IV | Dihexa is described as a stabilized analog. |
| Common analytical method | Reverse-phase high-performance liquid chromatography | Used for purity assessment. |
| Identity confirmation | Mass spectrometry | Provides a molecular mass check. |
| Regulatory status | Not approved for human use | Sold as a research chemical in many jurisdictions. |
Regulatory agencies have not approved dihexa as a prescription drug or supplement. In many countries it falls into a gray area when sold for laboratory research. Buyers may encounter products marketed for research use only, which are not intended for human consumption. Purity and identity can vary between suppliers and batches. Certificates of analysis and independent testing are often recommended for research materials. Documentation helps verify what a vial contains.
Discussion of dihexa in online communities sometimes outpaces the scientific record. Anecdotal reports are difficult to verify and may not distinguish effects from placebo or expectation. The absence of approved human data means long-term risks remain unknown. Researchers continue to investigate related compounds and pathways. Open questions include whether animal findings translate to humans and which biological targets matter most. No consensus exists on these points. Current reviews emphasize the need for rigorous clinical research.
Most published work on dihexa consists of preclinical studies using cell cultures or rodents. Reports have described effects on synaptic connectivity and performance on cognitive tasks in some animal models. These findings are generally presented as preliminary and require independent replication. Study designs, doses, and outcome measures vary across experiments, which complicates direct comparison. No large controlled human trials have established efficacy or safety for any medical use. At present, the evidence base is limited.
Dihexa is a synthetic peptide whose structure is modeled on angiotensin IV. Its chemical name often appears as N-hexanoic-Tyr-Ile-(6)-aminohexanoic amide, though vendor and publication naming can differ. The molecule combines a short amino acid sequence with a hexanoic acid group and an amide terminus. It is classed as a small research peptide rather than a conventional drug. Databases may list it under several synonyms, so matching names are important when comparing sources.
The angiotensin IV connection places dihexa in a family of short peptides studied for effects on central nervous system signaling. Angiotensin IV itself is a metabolite of angiotensin II, and analogs have been explored in cardiovascular and neurological research. Dihexa differs from the natural peptide through structural modifications intended to alter stability and receptor interactions. Published descriptions sometimes call it a hepatocyte growth factor mimetic, although that label reflects proposed activity rather than a confirmed clinical mechanism.
Dihexa is a synthetic peptide studied in laboratory research. It is often described as an angiotensin IV analog or a hepatocyte growth factor mimetic. The compound emerged from investigations into angiotensin IV and its effects on neural pathways. It is not an approved medication, and controlled human trials are lacking. In literature and online forums, it is discussed mainly as a research chemical. Its chemical name appears as N-hexanoic-Tyr-Ile-(6-aminohexanoic amide) in some sources.
Development of dihexa has been linked to academic research on synaptogenesis, the formation of new synapses. Preclinical studies in rodents have examined its effects on learning and memory tasks. These studies are often cited in discussions about cognitive enhancement, but they do not establish safety or efficacy in humans. The compound's patent and commercial history is limited, and it is not widely available through pharmaceutical channels. Most information comes from animal models and in vitro experiments. Researchers continue to explore its basic biology rather than clinical applications.
Dihexa is not approved for human use in the United States or the European Union. It is commonly sold as a research chemical, a category that may not require the same regulatory review as medicines. Buyers should note that product labels may lack independent verification of identity or purity. The legal status can vary by country, and importation may be restricted. Reliable information about sourcing and quality is often scarce. Scientific publications typically use synthesized material from laboratories rather than commercial consumer products.
Benazepril (Lotensin) Cilazapril (Inhibace) Enalapril (Vasotec/Renitec/Berlipril/Enap/Enalapril Profarma) Imidapril (Tanatril) Lisinopril (Listril/Lopril/Novatec/Prinivil/Zestril, Lisidigal) Moexipril (Univasc) Perindopril (Coversyl/Aceon/Perindo) Quinapril (Accupril) Ramipril (Altace/Prilace/Ramace/Ramiwin/Triatec/Tritace/Ramitac) Trandolapril (Mavik/Odrik/Gopten) Ceronapril (never marketed) Fosinopril (Fositen/Monopril) ACE inhibitor peptides can be derived from natural sources such as algae, fruit, seeds, dairy and animal products. A comprehensive resource on anti-hypertensive peptides is available in the form of a database. It contains around 1700 unique antihypertensive peptides. Arfalasin (HOE 409) is an angiotensin antagonist.
Leukolike vectors are a type of nanoparticles made of nanoporous silicon encapsulated by extracted native leukocyte membranes. These particles were among the first artificial white blood cells to be studied as a proof of concept of using cellular membranes to prolong circulation of nanoparticles throughout the blood. Studies have shown that leukolike vectors have a specific advantage in chemotherapy drug delivery to cancer. This is because leukolike vectors specifically have the potential to bind to tumor endothelium.
From Greek βίος (bíos) 'life', (from Proto-Indo-European root *gwei-, to live) and λογία (logia) 'study of'. The compound appears in the title of Volume 3 of Michael Christoph Hanow's Philosophiae naturalis sive physicae dogmaticae: Geologia, biologia, phytologia generalis et dendrologia, published in 1766. The term biology in its modern sense appears to have been introduced independently by Thomas Beddoes (in 1799), Karl Friedrich Burdach (in 1800), Gottfried Reinhold Treviranus (Biologie oder Philosophie der lebenden Natur, 1802) and Jean-Baptiste Lamarck (Hydrogéologie, 1802).
There are three amino acids with side chains that are cations at neutral pH: arginine (Arg, R), lysine (Lys, K) and histidine (His, H). Arginine has a charged guanidino group and lysine a charged alkyl amino group, and are fully protonated at pH 7. Histidine's imidazole group has a pKa of 6.0, and is only around 10% protonated at neutral pH. Because histidine is easily found in its basic and conjugate acid forms it often participates in catalytic proton transfers in enzyme reactions.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Sources: en.wikipedia.org
Degradation of an amino acid often begins with transamination, in which its amino group is transferred to α-ketoglutarate, forming glutamate. This process involves transaminases, often the same enzymes used in amino acid synthesis. In many vertebrates, the amino group is subsequently released as ammonia and converted to urea via the urea cycle for excretion. However, amino acid degradation can result in uric acid or ammonia instead, depending on the organism. For example, serine dehydratase converts serine directly to pyruvate and ammonia. After removal of one or more amino groups, the remaining carbon skeleton of an amino acid can serve as a precursor for synthesizing other amino acids, be further metabolized for energy after conversion into intermediates of glycolysis (typically via gluconeogenesis) or of the citric acid cycle, or be used for fatty acid synthesis and storage as triacylglycerol. Amino acids are bidentate ligands, forming transition metal amino acid complexes.
Cervical drug delivery is a route of carrying drugs into the body through the vagina and cervix. This is a form of localized drug delivery that prevents the drugs from impacting unintended areas of the body, which can lower side effects of toxic drugs such as chemotherapeutics. Cervical drug delivery has specific applications for a variety of female health issues: treatment of cervical cancer, pregnancy prevention, STD prevention, and STD treatment.
ASBMB Award for Exemplary Contributions to Education ASBMB Leadership Awards ASBMB–Merck Award ASBMB Young Investigator Award Avanti Award in Lipids Bert and Natalie Vallee Award in Biomedical Science DeLano Award for Computational Biosciences Earl and Thressa Stadtman Distinguished Scientist Award Earl and Thressa Stadtman Young Scholar Award Herbert Tabor Research Award Mildred Cohn Award in Biological Chemistry - The Mildred Cohn Award in Biological Chemistry was established in 2013 to honor the scientific achievements of Mildred Cohn. Cohn was the first female president of the society, in 1978. The award of $5,000 is presented annually to a scientist who has made substantial advances in understanding biological chemistry using innovative physical approaches. The recipient is expected to deliver the Mildred Cohn Award lecture at the annual meeting. Ruth Kirschstein Diversity in Science Award The Alice and C. C. Wang Award in Molecular Parasitology Walter A. Shaw Young Investigator Award in Lipid Research William C. Rose Award
In Mexico, the Directorate General of Civil Aviation (DGAC) investigates aviation accidents. In the Netherlands, the Dutch Safety Board (Onderzoeksraad voor Veiligheid) is responsible for the investigation of incidents and accidents, including air accidents. Its aim is the improvement of safety in the Netherlands. Its main focus is on those situations in which civilians are dependent on the government, companies or organizations for their safety. The Board solely investigates when incidents or accidents occur and aims to draw lessons from the results of these investigations. The Safety Board is objective, impartial and independent in its judgment. The Board will always be critical towards all parties concerned.
Sources: en.wikipedia.org
In many organisms including Xenopus and Drosophila, the midblastula transition usually occurs after a particular number of cell divisions for a given species, and is defined by the ending of the synchronous cell division cycles of the early blastula development, and the lengthening of the cell cycles by the addition of the G1 and G2 phases. Prior to this transition, cleavage occurs with only the synthesis and mitosis phases of the cell cycle. The addition of the two growth phases into the cell cycle allows for the cells to increase in size, as up to this point the blastomeres undergo reductive divisions in which the overall size of the embryo does not increase, but more cells are created. This transition begins the growth in size of the organism. The mid-blastula transition is also characterized by a marked increase in transcription of new, non-maternal mRNA transcribed from the genome of the organism. Large amounts of the maternal mRNA are destroyed at this point, either by proteins such as SMAUG in Drosophila or by microRNA. These two processes shift the control of the embryo from the maternal mRNA to the nuclei.
In 1884, Svante Arrhenius attributed the properties of acidity to hydrogen cations (H+), later described as protons or hydrons. An Arrhenius acid is a substance that, when added to water, increases the concentration of H+ ions in the water. Chemists often write H+(aq) and refer to the hydrogen cation when describing acid–base reactions but the free hydrogen nucleus, a proton, does not exist alone in water, it exists as the hydronium ion (H3O+) or other forms (H5O2+, H9O4+). Thus, an Arrhenius acid can also be described as a substance that increases the concentration of hydronium ions when added to water. Examples include molecular substances such as hydrogen chloride and acetic acid. An Arrhenius base, on the other hand, is a substance that increases the concentration of hydroxide (OH−) ions when dissolved in water. This decreases the concentration of hydronium because the ions react to form H2O molecules:
Although PI3K is the major mode of Akt activation, other tyrosine or serine/threonine kinases have been shown to activate Akt directly, in response to growth factors, inflammation or DNA damage. These can function even when PI3K activity is inhibited. Other studies have shown Akt can be activated in response to heat shock or increases in cellular Ca2+ concentration, via Ca2+/Calmodulin-dependent protein kinase kinase (CAMKK).
Sources: en.wikipedia.org
Dihexa has been reported to activate hepatocyte growth factor/c-Met signaling in cell studies. This pathway is linked to synapse formation and neuronal remodeling. The exact molecular interactions are not fully understood.
Reverse-phase high-performance liquid chromatography is commonly used to assess purity. Mass spectrometry is used to confirm molecular identity. These methods are typical for synthetic peptides and research chemicals.
Dihexa is not approved as a drug in major jurisdictions. It is often sold as a research chemical, which is not the same as a medicine. Its legal status can vary by country and may change.
It is thought to enhance hepatocyte growth factor signaling through the c-Met receptor. This pathway is involved in cell growth and repair. The precise molecular details are not fully established.