Everything below concerns Angiotensin IV. We keep the language plain, cite what the science says, and separate well-supported claims from open questions.
Last reviewed on 2026-05-30. Where a claim depends on a specific study, the study is described rather than over-claimed.
Animal studies have examined dihexa in models of cognitive impairment, synaptic plasticity, and memory. Some reports describe improved performance on maze or avoidance tasks after administration. These findings are preclinical and often involve small samples, varied routes, and differing formulations. Results in rodents do not establish effects in humans. The absence of published randomized controlled trials in people is a major gap in the evidence base. Observational reports and user accounts do not substitute for controlled clinical data.
Discussion in the literature often separates direct receptor activation from downstream growth-factor modulation. Dihexa is not simply an angiotensin receptor blocker or a classic nootropic drug. Its proposed action may depend on endogenous HGF levels, which vary by tissue and physiological state. Questions remain about brain penetration, metabolic stability, and active metabolites. Reviews note that mechanistic claims should be treated as hypotheses until supported by independent studies. That distinction is important when interpreting promotional claims or early laboratory findings.
The leading hypothesis for dihexa centers on hepatocyte growth factor (HGF) and its receptor, c-Met. In cell-based assays, dihexa has been reported to potentiate HGF-dependent signaling. That pathway influences cell growth, survival, and motility. Because c-Met signaling is widespread, the proposed mechanism is broad rather than specific to neurons. The exact binding site and stoichiometry remain areas of active investigation, and independent replication is limited. This uncertainty limits firm conclusions about how the compound acts in living organisms.
Dihexa is not approved as a medicine in major regulatory jurisdictions. It is commonly sold as a research chemical for laboratory use, though such products may not be standardized or independently verified. Scientific literature on dihexa includes in vitro assays, rodent studies, and reviews that discuss its proposed mechanism. The distinction between peer-reviewed findings and commercial promotion is important when evaluating available information. Open questions include its precise binding interactions, pharmacokinetics, and whether animal results translate to human biology.
Dihexa is a synthetic peptide derived from angiotensin IV, a naturally occurring fragment of the renin-angiotensin system. Researchers modified the angiotensin IV structure to improve metabolic stability and central nervous system activity. It is frequently described as a hepatocyte growth factor mimetic because it can activate the c-Met receptor pathway in experimental systems. Its development reflects interest in small peptides that influence synaptic plasticity and cognitive processes. Most information comes from preclinical studies rather than controlled human trials.
| Property | Value | Notes |
|---|---|---|
| Molecular target | HGF/c-Met pathway | Proposed, not fully confirmed |
| Research models | Rodent cognition assays | Results vary by study |
| Human trial data | Limited or absent | No approved clinical use |
| Metabolic stability | Uncertain | Peptide degradation possible |
| Blood-brain barrier | Under investigation | Lipophilicity may affect distribution |
Regulatory agencies have not approved dihexa as a prescription drug or supplement. In many countries it falls into a gray area when sold for laboratory research. Buyers may encounter products marketed for research use only, which are not intended for human consumption. Purity and identity can vary between suppliers and batches. Certificates of analysis and independent testing are often recommended for research materials. Documentation helps verify what a vial contains.
Discussion of dihexa in online communities sometimes outpaces the scientific record. Anecdotal reports are difficult to verify and may not distinguish effects from placebo or expectation. The absence of approved human data means long-term risks remain unknown. Researchers continue to investigate related compounds and pathways. Open questions include whether animal findings translate to humans and which biological targets matter most. No consensus exists on these points. Current reviews emphasize the need for rigorous clinical research.
Dihexa is a synthetic peptide with the chemical name N-hexanoic-Tyr-Ile-(6)-aminohexanoic amide, and it is structurally related to angiotensin IV, a naturally occurring peptide fragment. Researchers developed it as a modified analog intended to alter stability and activity relative to the parent peptide. Its short sequence and fatty acid chain distinguish it from many endogenous peptides, and published studies often describe it under the abbreviation dihexa. The compound is classified as a laboratory compound rather than an approved therapeutic in most jurisdictions.
Early laboratory work focused on its effects on synaptic connectivity and neuronal signaling. In cell and animal models, dihexa has been reported to promote the formation of new synapses, a process called synaptogenesis. These findings have generated interest in cognitive research, but the evidence base remains mostly preclinical. Human clinical trials with clear safety and efficacy endpoints are limited or absent in the public literature. Whether these effects translate to humans is an open question.
The angiotensin IV connection places dihexa in a family of short peptides studied for effects on central nervous system signaling. Angiotensin IV itself is a metabolite of angiotensin II, and analogs have been explored in cardiovascular and neurological research. Dihexa differs from the natural peptide through structural modifications intended to alter stability and receptor interactions. Published descriptions sometimes call it a hepatocyte growth factor mimetic, although that label reflects proposed activity rather than a confirmed clinical mechanism.
Identity checks for dihexa usually rely on mass spectrometry and chromatographic purity analysis. A lyophilized powder is the common supplied form, and it may appear as a white to off-white solid. Aqueous solubility is limited, so laboratory work often uses an organic solvent such as dimethyl sulfoxide to prepare stock solutions. Because the peptide is not a standard pharmaceutical product, exact specifications can vary between suppliers. Certificates of analysis may accompany a batch, but they are not equivalent to regulatory approval.
Dihexa is a synthetic peptide whose structure is modeled on angiotensin IV. Its chemical name often appears as N-hexanoic-Tyr-Ile-(6)-aminohexanoic amide, though vendor and publication naming can differ. The molecule combines a short amino acid sequence with a hexanoic acid group and an amide terminus. It is classed as a small research peptide rather than a conventional drug. Databases may list it under several synonyms, so matching names are important when comparing sources.
The proposed mechanism for dihexa centers on hepatocyte growth factor, or HGF, and its receptor c-Met. HGF signaling is involved in cell growth, survival, and synapse formation. Dihexa has been described as an HGF mimetic or modulator in preclinical literature. Whether it binds c-Met directly, increases HGF availability, or acts through another route remains uncertain. This mechanistic uncertainty is a recurring theme in reviews of the compound, and no single molecular model has been confirmed across independent laboratories.
Research on dihexa has primarily used rodent models and cultured cells. Common endpoints include dendritic spine density, synaptic protein expression, and performance on maze or avoidance tasks. Some studies report improvements in cognitive measures after scopolamine-induced deficits or in aged animals. These findings are interesting but come from a small body of work, and independent laboratories have not consistently replicated all reported effects. Larger, preregistered studies would help clarify which results are robust.
Human data for dihexa remain absent from peer-reviewed clinical literature. As a result, questions about absorption, distribution, metabolism, excretion, and long-term safety are unresolved. Discussions often appear in nootropic forums, where anecdotal reports cannot substitute for controlled trials. Researchers have called for more rigorous pharmacokinetic and toxicological studies before any clinical evaluation. Until such data exist, dihexa is best described as an investigational research compound rather than a proven intervention.
The citric acid cycle is regulated mainly by the availability of key substrates, particularly the ratio of NAD+ to NADH and the concentrations of calcium, inorganic phosphate, ATP, ADP, and AMP. Citrate – the ion that gives its name to the cycle – is a feedback inhibitor of citrate synthase and also inhibits PFK, providing a direct link between the regulation of the citric acid cycle and glycolysis.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
A lot of effort has been put into controlling cell selectivity. For example, attempts have been made to modify and optimize the physicochemical parameters of the peptides to control the selectivities, including net charge, helicity, hydrophobicity per residue (H), hydrophobic moment (μ) and the angle subtended by the positively charged polar helix face (Φ). Other mechanisms like the introduction of D-amino acids and fluorinated amino acids in the hydrophobic phase are believed to break the secondary structure and thus reduce hydrophobic interaction with mammalian cells. It has also been found that Pro→Nlys substitution in Pro-containing β-turn antimicrobial peptides was a promising strategy for the design of new small bacterial cell-selective antimicrobial peptides with intracellular mechanisms of action. It has been suggested that direct attachment of magainin to the substrate surface decreased nonspecific cell binding and led to improved detection limit for bacterial cells such as Salmonella and E. coli.
Combination of TMA-2 with harmaline or ibogaine has been reported to result in long-lasting episodes complicated by severe psychomotor agitation. TMA-2's affinity (Ki) for the serotonin 5-HT2A receptor has been found to be 1,300 nM. Its EC50Tooltip half-maximal effective concentration at the receptor was 190 nM and its EmaxTooltip maximal efficacy was 84%. The drug was also active at the serotonin 5-HT2B receptor and, to a much lesser extent, at the serotonin 5-HT2C receptor. In an earlier study, its affinities (Ki) were 1,650 nM at the serotonin 5-HT2 receptor and 46,400 nM at the serotonin 5-HT1 receptor. TMA-2 is inactive at the monoamine transporters. It was inactive at the mouse trace amine-associated receptor 1 (TAAR1), whereas it bound to the rat TAAR1 with an affinity (Ki) of 3,100 nM and was not assessed at the human TAAR1. In terms of metabolism, TMA-2 is known to be at least partially O-demethylated in animals in vivo. It might produce 2,4,5-trihydroxyamphetamine (THA) as a metabolite. The pharmacokinetics and metabolism of TMA-2 in humans are unknown.
Accumulation of amyloid proteins in the gastrointestinal system may be caused by a wide range of amyloid disorders and have different presentations depending on the degree of organ involvement. Potential symptoms include weight loss, diarrhea, abdominal pain, heartburn (gastrointestinal reflux), and GI bleeding. Amyloidosis may also affect accessory digestive organs including the liver, and may present with jaundice, fatty stool, anorexia, fluid buildup in the abdomen, and spleen enlargement. Accumulation of amyloid proteins in the liver can lead to elevations in serum aminotransferases and alkaline phosphatase, two biomarkers of liver injury, which is seen in about one third of people. Liver enlargement is common. In contrast, spleen enlargement is rare, occurring in 5% of people. Splenic dysfunction, leading to the presence of Howell-Jolly bodies on blood smear, occurs in 24% of people with amyloidosis. Malabsorption is seen in 8.5% of AL amyloidosis and 2.4% of AA amyloidosis. One suggested mechanism for the observed malabsorption is that amyloid deposits in the tips of intestinal villi (fingerlike projections that increase the intestinal area available for absorption of food), begin to erode the functionality of the villi, presenting a sprue-like picture.
Sources: en.wikipedia.org
{\displaystyle \langle \Psi _{nlm_{l}m_{s}}|\mu |\Psi _{n'l'm_{l}'m_{s}'}\rangle } For example in the E1 transition, unless Δ l = ± 1, Δ ml = 0 or ± 1, Δ ms = 0, and Δ n = any integer, the equation above will yield a value equal to zero and the transition would be known as a “forbidden transition”. For example, this would occur for certain cases like when Δ l = 2. In this case, the transition would not be allowed and therefore would be much weaker than an allowed transition. These specific values for the changes in quantum numbers are known as the selection rules for the allowed transitions and are shown for common transitions in the table below: Cold vapour atomic fluorescence spectroscopy Atomic spectral line Prospects in Analytical Atomic Spectrometry – tendencies in five main branches of atomic spectrometry (absorption, emission, mass, fluorescence and ionization spectrometry) Learning by Simulations – various atomic absorption and emission spectra Atomic Spectroscopy: A Compendium of Basic Ideas, Notation, Data, and Formulas
3-Aminoacetanilide is a chemical compound which is an amino derivative of acetanilide and meta-isomer of aminoacetanilide. There are two other isomers of aminoacetanilide, 2-aminoacetanilide and 4-aminoacetanilide. Aminoacetanilide derivatives are important synthetic intermediates in heterocyclic and aromatic synthesis. These derivatives have found applications in pharmaceutical industry and dyes and pigment industry. A number of methods are available to synthesize 3'-aminoacetanilide. It could be prepared by reduction of m-nitroacetanilide. m-Chloroacetanilde has been converted into m-aminoacetanilide. 3′-Aminoacetanilide has been used in the preparation of azo compounds, pyrrole, imidazole, thiazole and other heterocycles. It is starting material for Trametinib. It is also used to prepare reactive yellow K-RN and dispersed dye.
Automated synthesis systems find new applications with a development of new robotic platforms. Possible applications include: uncontrolled synthesis, time-dependent synthesis, radiosynthesis, synthesis in demanding conditions (low temperatures, presence of specific atmosphere like CO, H2, N2, high pressure or under vacuum) or whenever the same or similar workflow needs to be applied multiple times with the aim to: optimize reactions, synthesize many derivatives in small scale, perform reactions of iterative homologations or radiosynthesis. Automated synthesis workflows are needed both in academic research and a wide array of industrial R&D settings (pharmaceuticals, agrochemicals, fine & specialty chemicals, renewables & energy research, catalysts, polymers, ceramics & abrasives, porous materials, nanomaterials, biomaterials, lubricants, paints & coatings, home care, personal care, nutrition, forensics).
RCO2H + R'2NH → RCO−2 + R'2NH+2 RCO−2 + R'2NH+2 → RC(O)NR'2 + H2O Esters are far superior substrates relative to carboxylic acids. Further "activating" both acid chlorides (Schotten-Baumann reaction) and anhydrides (Lumière–Barbier method) react with amines to give amides: RCO2R" + R'2NH → RC(O)NR'2 + R"OH RCOCl + 2R'2NH → RC(O)NR'2 + R'2NH+2Cl− (RCO)2O + R'2NH → RC(O)NR'2 + RCO2H Peptide synthesis use coupling agents such as HATU, HOBt, or PyBOP. The hydrolysis of nitriles is conducted on an industrial scale to produce fatty amides. Laboratory procedures are also available. Many specialized methods also yield amides. A variety of reagents, e.g. tris(2,2,2-trifluoroethyl) borate have been developed for specialized applications. Amidogen Amino radical Imidic acid Metal amides IUPAC Compendium of Chemical Terminology
Sources: en.wikipedia.org
It is thought to enhance hepatocyte growth factor signaling through the c-Met receptor. This pathway is involved in cell growth and repair. The precise molecular details are not fully established.
Published human trials are lacking. Most data come from cell cultures and animal models. Therefore, clinical effects and safety in people are uncertain.
It has been promoted in online communities for cognitive enhancement. That discussion is based largely on preclinical findings. It does not constitute evidence of efficacy or safety.
Dihexa is a synthetic peptide derived from angiotensin IV and studied for effects on synaptic plasticity. It is often described as a hepatocyte growth factor mimetic. It is not an approved medication.