This is a working overview of Research chemical, written for readers who want more than a one-paragraph summary but less than a textbook.
This page was last updated on 2026-06-15 and is reviewed periodically as new material appears.
Dihexa is typically supplied as a lyophilized powder for laboratory research. Lyophilization removes water and improves stability during transport and storage. The solid is commonly stored at -20 °C or lower, desiccated, and protected from light. Repeated freeze-thaw cycles and exposure to moisture can degrade peptides, so aliquoting and sealed containers are standard practice in most laboratory settings. These handling measures apply to research-grade material and do not imply clinical suitability.
Purity and identity are usually assessed with reverse-phase high-performance liquid chromatography (RP-HPLC) and mass spectrometry. RP-HPLC separates components by hydrophobicity and can estimate peptide purity. Mass spectrometry confirms molecular mass and helps detect truncations or modifications. Some laboratories also use amino acid analysis or nuclear magnetic resonance for structural verification. A certificate of analysis from a supplier may list these results, but independent verification is often recommended for critical work.
Regulatory status varies by country, and dihexa is not widely approved as a medicine. In many jurisdictions it is treated as a research chemical, which limits its legal sale, possession, and human use. Products marketed online may lack verified purity or identity, and labels can be inaccurate. Researchers typically source material from suppliers that provide analytical documentation and follow institutional safety rules. Open questions remain about long-term stability, metabolite formation, and human pharmacokinetics.
Dissolution depends on the peptide’s salt form, purity, and the chosen solvent. Dimethyl sulfoxide is commonly used to prepare concentrated stock solutions, while aqueous buffers may show limited solubility. Sonication or gentle warming can sometimes aid dissolution, but excessive heat may promote degradation. Once in solution, the material is generally kept cold and protected from light. Researchers should verify solubility for each lot rather than assuming uniform behavior across suppliers.
Quality control usually combines reverse-phase high-performance liquid chromatography with mass spectrometry. Chromatography estimates purity and detects related impurities, while mass spectrometry supports molecular identity. Nuclear magnetic resonance can provide additional structural confirmation when needed. Stability data for dihexa are limited, and degradation pathways may depend on pH, temperature, and moisture. Open questions include long-term stability in different formulations and the effect of repeated freeze-thaw cycles on measured purity. Such tests help confirm that a batch matches its label before use.
| Property | Value | Notes |
|---|---|---|
| Appearance | White to off-white powder | Typical lyophilized research form. |
| Solubility | Soluble in DMSO; limited in water | Depends on purity and salt form. |
| Storage temperature | -20 °C or lower | Desiccated and protected from light. |
| Analytical method | RP-HPLC and LC-MS | Common for purity and identity. |
| Regulatory status | Research chemical in many countries | Not widely approved as a medicine. |
Identity checks for dihexa usually rely on mass spectrometry and chromatographic purity analysis. A lyophilized powder is the common supplied form, and it may appear as a white to off-white solid. Aqueous solubility is limited, so laboratory work often uses an organic solvent such as dimethyl sulfoxide to prepare stock solutions. Because the peptide is not a standard pharmaceutical product, exact specifications can vary between suppliers. Certificates of analysis may accompany a batch, but they are not equivalent to regulatory approval.
Dihexa is a synthetic peptide whose structure is modeled on angiotensin IV. Its chemical name often appears as N-hexanoic-Tyr-Ile-(6)-aminohexanoic amide, though vendor and publication naming can differ. The molecule combines a short amino acid sequence with a hexanoic acid group and an amide terminus. It is classed as a small research peptide rather than a conventional drug. Databases may list it under several synonyms, so matching names are important when comparing sources.
The angiotensin IV connection places dihexa in a family of short peptides studied for effects on central nervous system signaling. Angiotensin IV itself is a metabolite of angiotensin II, and analogs have been explored in cardiovascular and neurological research. Dihexa differs from the natural peptide through structural modifications intended to alter stability and receptor interactions. Published descriptions sometimes call it a hepatocyte growth factor mimetic, although that label reflects proposed activity rather than a confirmed clinical mechanism.
Dihexa appears in scientific literature, patent documents, and commercial catalogs under several names, which can complicate searching and verification. The compound is frequently grouped with nootropics or research chemicals, terms that describe context of use rather than regulatory approval. Such labeling may imply benefits that have not been confirmed in controlled human studies. Readers encountering promotional descriptions should distinguish between preclinical observations and established medical facts. The absence of regulatory approval is a central feature of its current status.
Dihexa is a synthetic peptide-like compound studied in preclinical research for its reported effects on synaptic growth and cognitive measures in animal models. It is often described as an analog of angiotensin IV, a naturally occurring peptide fragment. The compound has not been approved as a medicine in any major jurisdiction. Most public information comes from laboratory studies, patents, and online vendor listings rather than from large clinical trials. Its scientific status therefore differs from that of an established pharmaceutical.
Regulatory and commercial contexts differ from clinical medicine. Dihexa is not approved as a drug by major agencies, and no published human trials establish its safety or efficacy. It is often sold as a research chemical labeled for laboratory use only. Suppliers may provide certificates of analysis, but purity and identity depend on the specific batch. Legal status varies by country and may treat such compounds as unapproved substances for human consumption.
Dihexa is a synthetic peptidomimetic derived from angiotensin IV, a naturally occurring peptide fragment. It was created as a research compound to explore central nervous system signaling rather than as an approved therapeutic. Early work described it as a small, orally available molecule in rodent studies. Its structure combines tyrosine, isoleucine, and aminohexanoic acid components with a hexanoic acid cap. The compound is commonly referred to by the research code PNB-0408.
Development of dihexa followed from studies on angiotensin IV analogs and their effects on learning and memory. Researchers sought compounds with improved metabolic stability and brain penetration compared with natural peptides. In preclinical reports, dihexa was associated with changes in synaptic connectivity and performance on spatial tasks. These findings generated interest in its potential as a cognitive research tool. The work remains largely preclinical, and independent replication has been limited.
Databases are essential for bioinformatics research and applications. Databases exist for many different information types, including DNA and protein sequences, molecular structures, phenotypes and biodiversity. Databases can contain both empirical data (obtained directly from experiments) and predicted data (obtained from analysis of existing data). They may be specific to a particular organism, pathway or molecule of interest. Alternatively, they can incorporate data compiled from multiple other databases. Databases can have different formats, access mechanisms, and be public or private. Some of the most commonly used databases are listed below: Used in biological sequence analysis: Genbank, UniProt Used in structure analysis: Protein Data Bank (PDB) Used in finding Protein Families and Motif Finding: InterPro, Pfam Used for Next Generation Sequencing: Sequence Read Archive Used in Network Analysis: Metabolic Pathway Databases (KEGG, BioCyc), Interaction Analysis Databases, Functional Networks Used in design of synthetic genetic circuits: GenoCAD
As anti-angiogenic cancer therapies have achieved widespread use, there has been increased interest in non-invasive monitoring of angiogenesis. One of the most extensively examined targets of angiogenesis is integrin αVβ3. Radiolabeled peptides containing RGD show high affinity and selectivity for integrin αVβ3 and are being investigated as tools to monitor treatment response of tumors via PET imaging. These include 18F-Galacto-RGD, 18F-Fluciclatide-RGD, 18F-RGD-K5, 68Ga-NOTA-RGD, 68Ga-NOTA-PRGD2, 18F-Alfatide, 18F-Alfatide II, and 18F-FPPRGD2. In a meta-analysis of studies using PET/CT in patients with cancer, it was shown that this diagnostic method may be very useful for detecting malignancies and predicting short-term outcomes, although larger-scale studies are needed.
Aspartic acid was first discovered in 1827 by Auguste-Arthur Plisson and Étienne-Ossian Henry by hydrolysis of asparagine, which had been isolated from asparagus juice in 1806. Their original method used lead hydroxide, but various other acids or bases are now more commonly used instead. There are two forms or enantiomers of aspartic acid. The name "aspartic acid" can refer to either enantiomer or a mixture of two. Of these two forms, only one, "L-aspartic acid", is directly incorporated into proteins. The biological roles of its counterpart, "D-aspartic acid" are more limited. Where enzymatic synthesis will produce one or the other, most chemical syntheses will produce both forms, "DL-aspartic acid", known as a racemic mixture. In the human body, aspartate is most frequently synthesized through the transamination of oxaloacetate. The biosynthesis of aspartate is facilitated by an aminotransferase enzyme: the transfer of an amine group from another molecule such as alanine or glutamine yields aspartate and an alpha-keto acid.
1-Ethyl-3-(3-dimethylaminopropyl)carbodiimide (EDC, EDAC or EDCI) is a water-soluble carbodiimide usually handled as the hydrochloride, which is a white solid. It is typically employed in the 4.0-6.0 pH range. It is generally used as a carboxyl activating agent for the coupling of primary amines to yield amide bonds. While other carbodiimides like dicyclohexylcarbodiimide (DCC) or diisopropylcarbodiimide (DIC) are also employed for this purpose, EDC has the advantage that the urea byproduct formed (often challenging to remove in the case of DCC or DIC) can be washed away from the amide product using dilute acid. Additionally, EDC can also be used to activate phosphate groups in order to form phosphomonoesters and phosphodiesters. Common uses for this carbodiimide include peptide synthesis, protein crosslinking to nucleic acids, but also in the preparation of immunoconjugates. EDC is often used in combination with N-hydroxysuccinimide (NHS) for the immobilisation of large biomolecules. Recent work has also used EDC to assess the structure state of uracil nucleobases in RNA.
Sources: en.wikipedia.org
The histology of ALK-negative ALCL, similar to ALK-positive ALCL, consist of "hallmark" cells that strongly express CD30. Unlike ALK-positive ALCL, however, ALK-negative ALC does not fall into different morphological patterns. The histological of this disease may overlap with and be difficult to distinguish from other CD30-positive T-cell lymphomas or the nodular sclerosis form of Hodgkin lymphoma. Cases in which ALK-negative ALCL is not distinguishable from the latter lymphomas are best diagnosed as peripheral T-cell lymphoma not otherwise specified (PTL, NOS). The histology of ALK-negative ALCL may also overlap with tumors of non–T-cell lineage such as various carcinomas. The differential diagnoses of ambiguous cases may be helped by examining the tumor cells for the expression of certain marker proteins. For example, expression of CD56, MUC1 (also termed EMA for epithelial membrane antigen), and clusterin and strong uniform expression of CD30 support the diagnosis of ALK-negative ALCL over PTL, NOS, while variable CD30 expression and extensive expression of T-cell receptor proteins favor PTCL-NOS over ALK-negative ALCL. Detection of certain gene abnormalities (see next section) may also help distinguishing these diseases.
Isoforms I, III, and VIII are also stimulated by Ca2+/calmodulin. Isoforms V and VI are inhibited by Ca2+ in a calmodulin-independent manner. Isoforms II, IV and IX are stimulated by alpha subunit of the G protein. Isoforms I, V and VI are most clearly inhibited by Gi, while other isoforms show less dual regulation by the inhibitory G protein. Soluble AC (sAC) is not a transmembrane form and is not regulated by G proteins or forskolin, instead acts as a bicarbonate/pH sensor. It is anchored at various locations within the cell and, with phosphodiesterases, forms local cAMP signalling domains. In neurons, calcium-sensitive adenylyl cyclases are located next to calcium ion channels for faster reaction to Ca2+ influx; they are suspected of playing an important role in learning processes. This is supported by the fact that adenylyl cyclases are coincidence detectors, meaning that they are activated only by several different signals occurring together. In peripheral cells and tissues adenylyl cyclases appear to form molecular complexes with specific receptors and other signaling proteins in an isoform-specific manner.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Aerosol mass spectrometry is the application of mass spectrometry to the analysis of the composition of aerosol particles. Aerosol particles are defined as solid and liquid particles suspended in a gas (air), with size range of 3 nm to 100 μm in diameter and are produced from natural and anthropogenic sources, through a variety of different processes that include wind-blown suspension and combustion of fossil fuels and biomass. Analysis of these particles is important owing to their major impacts on global climate change, visibility, regional air pollution and human health. Aerosols are very complex in structure, can contain thousands of different chemical compounds within a single particle, and need to be analysed for both size and chemical composition, in real-time or off-line applications. Off-line mass spectrometry is performed on collected particles, while on-line mass spectrometry is performed on particles introduced in real time.
Alfred Stracher (1931-2013) was an American biochemist and the founder and editor-in-chief of Drug Delivery. During his lifetime, he was Distinguished Professor of Biochemistry at SUNY Downstate Medical Center. Alfred Stracher was born in Albany, New York in 1931. He graduated from Rensselaer Polytechnic Institute in 1952 with a Bachelor of Science in Chemistry. He received his PhD in Chemistry from Columbia University in 1956.
Sources: en.wikipedia.org
The lyophilized powder is generally stored at -20 °C or lower, desiccated, and protected from light. Solutions are often aliquoted to avoid repeated freeze-thaw cycles. Specific stability data may vary by formulation and purity.
Mass spectrometry is commonly used to confirm molecular mass, while RP-HPLC estimates purity. These methods can be combined with amino acid analysis or NMR for further structural confirmation. A certificate of analysis alone does not guarantee independent verification.
Legality depends on the country and the intended use. In many places it is not approved as a drug and may be regulated as a research chemical. Buyers should check local laws and institutional policies before obtaining it.
Typical storage is at -20 °C in a desiccated container protected from light. Repeated freeze-thaw cycles are usually minimized to reduce degradation. Specific conditions should follow the supplier’s documentation.